Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DARS Rabbit Polyclonal Antibody (FITC)

DARS Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DARS, HBSL, aspRS

UniProt

P14868

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DARS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTDSPL Rabbit Polyclonal Antibody (BF350)
orb2429228 100 µL

CTDSPL Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
OxiSelect Human Oxidized HDL ELISA Kit (MDA-HDL Quantitation)
MBS168252-01 96 Assays

OxiSelect Human Oxidized HDL ELISA Kit (MDA-HDL Quantitation)

Sign In for Pricing
View Details
OxiSelect Human Oxidized HDL ELISA Kit (MDA-HDL Quantitation)
MBS168252-02 5x 96 Assays

OxiSelect Human Oxidized HDL ELISA Kit (MDA-HDL Quantitation)

Sign In for Pricing
View Details
Lentiviral mouse Tspan31 shRNA (UAS) - Lentiviral mouse Tspan31 shRNA (UAS, RFP) (100)
GTR15213252 1 Vial

Lentiviral mouse Tspan31 shRNA (UAS) - Lentiviral mouse Tspan31 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PEPCK2, NT (Phosphoenolpyruvate Carboxykinase 2 (Mitochondrial), PEPCK-2, PEPCK, PCK2, Mitochondrial Phosphoenolpyruvate Carboxykinase 2, Phosphoenolpyruvate Carboxykinase [GTP] Mitochondrial, PEPCK-M, PEP Carboxykinase, Phosphoenolpyruvate Carboxylase) (
MBS6492662-01 0.1 mL

PEPCK2, NT (Phosphoenolpyruvate Carboxykinase 2 (Mitochondrial), PEPCK-2, PEPCK, PCK2, Mitochondrial Phosphoenolpyruvate Carboxykinase 2, Phosphoenolpyruvate Carboxykinase [GTP] Mitochondrial, PEPCK-M, PEP Carboxykinase, Phosphoenolpyruvate Carboxylase) (

Sign In for Pricing
View Details
PEPCK2, NT (Phosphoenolpyruvate Carboxykinase 2 (Mitochondrial), PEPCK-2, PEPCK, PCK2, Mitochondrial Phosphoenolpyruvate Carboxykinase 2, Phosphoenolpyruvate Carboxykinase [GTP] Mitochondrial, PEPCK-M, PEP Carboxykinase, Phosphoenolpyruvate Carboxylase) (
MBS6492662-02 5x 0.1 mL

PEPCK2, NT (Phosphoenolpyruvate Carboxykinase 2 (Mitochondrial), PEPCK-2, PEPCK, PCK2, Mitochondrial Phosphoenolpyruvate Carboxykinase 2, Phosphoenolpyruvate Carboxykinase [GTP] Mitochondrial, PEPCK-M, PEP Carboxykinase, Phosphoenolpyruvate Carboxylase) (

Sign In for Pricing
View Details