Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL24 Rabbit Polyclonal Antibody (FITC)

RPL24 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L24, HEL-S-310

UniProt

P83731

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPL24

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRX V Double Nickase Plasmid (h2)
sc-402681-NIC-2 20 µg

PRX V Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
OLIG2, NT (OLIGO2, RACK17, PRKCBP2, BHLHB1, BHLHE19, Oligodendrocyte transcription factor 2, Class B basic helix-loop-helix protein 1, Oligo2)
352414 100 µg

OLIG2, NT (OLIGO2, RACK17, PRKCBP2, BHLHB1, BHLHE19, Oligodendrocyte transcription factor 2, Class B basic helix-loop-helix protein 1, Oligo2)

Sign In for Pricing
View Details
Human Dynein light chain 1, cytoplasmic (DYNLL1/DLC1/DNCL1/DNCLC1/HDLC1) ELISA Kit
EIA07475h 1 Kit

Human Dynein light chain 1, cytoplasmic (DYNLL1/DLC1/DNCL1/DNCLC1/HDLC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Satl1 Pre-designed siRNA Set A
SI112493A 1 Each

Mouse Satl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Boc-D-Thr (Bzl) -OH
HY-15400-01 5 g

Boc-D-Thr (Bzl) -OH

Sign In for Pricing
View Details
Boc-D-Thr (Bzl) -OH
HY-15400-02 10 g

Boc-D-Thr (Bzl) -OH

Sign In for Pricing
View Details