Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL24 Rabbit Polyclonal Antibody (HRP)

RPL24 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L24, HEL-S-310

UniProt

P83731

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPL24

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AJUBA (NM_032876) Human Recombinant Protein
TP305482M 100 µg

AJUBA (NM_032876) Human Recombinant Protein

Sign In for Pricing
View Details
AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody
TA368691 100 µL

AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Ethyl-N-(2-hydroxyethyl)perfluorooctanesulfonamide Phosphate Diester
TRC-E678835-25MG 25 mg

N-Ethyl-N-(2-hydroxyethyl)perfluorooctanesulfonamide Phosphate Diester

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), 1mg/mL
BNUM0521-50 1x 50 µL

AFP (Alpha Fetoprotein) (MBS-12), 1mg/mL

Sign In for Pricing
View Details
Mouse C3 activation kit by CRISPRa
GA200465 1 Kit

Mouse C3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Lymphoid tissue
CP565815 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details