Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYBB1 Rabbit Polyclonal Antibody (Biotin)

CRYBB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CATCN3, CTRCT17

UniProt

P53674

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CRYBB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Clara Cell Protein 16 (CC16) ELISA Kit
orb2813034-01 48 Tests

Human Clara Cell Protein 16 (CC16) ELISA Kit

Sign In for Pricing
View Details
Human Clara Cell Protein 16 (CC16) ELISA Kit
orb2813034-02 96 Tests

Human Clara Cell Protein 16 (CC16) ELISA Kit

Sign In for Pricing
View Details
Human Clara Cell Protein 16 (CC16) ELISA Kit
orb2813034-03 5 x 96 T

Human Clara Cell Protein 16 (CC16) ELISA Kit

Sign In for Pricing
View Details
PVRL2 (Poliovirus Receptor-related 2, HVEB, PRR2, CD112, PVRR2, Nectin-2) (FITC)
MBS6434342-01 0.1 mL

PVRL2 (Poliovirus Receptor-related 2, HVEB, PRR2, CD112, PVRR2, Nectin-2) (FITC)

Sign In for Pricing
View Details
PVRL2 (Poliovirus Receptor-related 2, HVEB, PRR2, CD112, PVRR2, Nectin-2) (FITC)
MBS6434342-02 5x 0.1 mL

PVRL2 (Poliovirus Receptor-related 2, HVEB, PRR2, CD112, PVRR2, Nectin-2) (FITC)

Sign In for Pricing
View Details
ZEB2, CT (ZEB2, KIAA0569, SIP1, ZFHX1B, ZFX1B, Zinc finger E-box-binding homeobox 2, Smad-interacting protein 1, Zinc finger homeobox protein 1b) (MaxLight 650)
MBS6365103-01 0.1 mL

ZEB2, CT (ZEB2, KIAA0569, SIP1, ZFHX1B, ZFX1B, Zinc finger E-box-binding homeobox 2, Smad-interacting protein 1, Zinc finger homeobox protein 1b) (MaxLight 650)

Sign In for Pricing
View Details