Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD3 Rabbit Polyclonal Antibody (HRP)

SMARCD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rsc6p, BAF60C, CRACD3

UniProt

Q6STE5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SMARCD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Protein N terminal asparagine amidohydrolase (NTAN1) ELISA kit
GTR10385037 96 Well

Chicken Protein N terminal asparagine amidohydrolase (NTAN1) ELISA kit

Sign In for Pricing
View Details
G-Protein, alpha (Gai1) (BSA & Azide Free) (MaxLight 405)
MBS6267122-01 0.1 mL

G-Protein, alpha (Gai1) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
G-Protein, alpha (Gai1) (BSA & Azide Free) (MaxLight 405)
MBS6267122-02 5x 0.1 mL

G-Protein, alpha (Gai1) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF568 conjugate, 0.1mg/mL
BNC681537-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TAS2R7 (Taste 2 receptor member 7) for Antibody Discovery
MP1342X Each

Magic™ Membrane Protein Human TAS2R7 (Taste 2 receptor member 7) for Antibody Discovery

Sign In for Pricing
View Details
Rabbit Polyclonal CAPRIN2 Antibody
NBP1-88318-25ul 25 µL

Rabbit Polyclonal CAPRIN2 Antibody

Sign In for Pricing
View Details