Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF1B, Human (His)

EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif1b-protein-human-his.html

Smiles

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Molecular Formula

10289 (Gene_ID) O60739 (M1-F113) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Acetyl-2,3-dihydro-5-[2-[[2-[2-(2,2,2-trifluoroethoxy)phenoxy]ethyl]amino]propyl]-1H-indole-7-carbonitrile
TRC-A077835-100MG 100 mg

1-Acetyl-2,3-dihydro-5-[2-[[2-[2-(2,2,2-trifluoroethoxy)phenoxy]ethyl]amino]propyl]-1H-indole-7-carbonitrile

Sign In for Pricing
View Details
Slc29a4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6332705 3x 1.0 µg

Slc29a4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
QTRT2 Rabbit Polyclonal Antibody (Fluoro550)
orb3091889 100 µg

QTRT2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Human Activin C
1629-AC-010 10 µg

Recombinant Human Activin C

Sign In for Pricing
View Details
Rabbit Anti-Human FADD pAb
PA10153-01 50 μL

Rabbit Anti-Human FADD pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FADD pAb
PA10153-02 100 μL

Rabbit Anti-Human FADD pAb

Sign In for Pricing
View Details