EIF1B, Human (His)
EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
EIF1B Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eif1b-protein-human-his.html
Smiles
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Molecular Formula
10289 (Gene_ID) O60739 (M1-F113) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog