Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF1B, Human (His)

EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EIF1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif1b-protein-human-his.html

Smiles

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Molecular Formula

10289 (Gene_ID) O60739 (M1-F113) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-DL-Phe-OtBu·HCl
5-03303 5 g

H-DL-Phe-OtBu·HCl

Sign In for Pricing
View Details
Nfix Antibody Middle region
ARP90434_P050 100 µL

Nfix Antibody Middle region

Sign In for Pricing
View Details
TPST2 antibody - middle region
MBS3207436-01 0.1 mL

TPST2 antibody - middle region

Sign In for Pricing
View Details
TPST2 antibody - middle region
MBS3207436-02 5x 0.1 mL

TPST2 antibody - middle region

Sign In for Pricing
View Details
Human SIGLEC15 Protein Lysate
MBS8419447-01 0.02 mg

Human SIGLEC15 Protein Lysate

Sign In for Pricing
View Details
Human SIGLEC15 Protein Lysate
MBS8419447-02 5x 0.02 mg

Human SIGLEC15 Protein Lysate

Sign In for Pricing
View Details