Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSG1 Rabbit Polyclonal Antibody (HRP)

LSG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSG1

UniProt

Q9H089

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LSG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHLDM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAAF01418-100UG - EIF2AK2 Antibody
OAAF01418-100UG 100 µg

OAAF01418-100UG - EIF2AK2 Antibody

Sign In for Pricing
View Details
RFX4 (h) -PR
sc-95773-PR 10 µM - 20 µL

RFX4 (h) -PR

Sign In for Pricing
View Details
FT011 10mM * 1mL in DMSO
A20333-10mM-D 10 mM x 1mL in DMSO

FT011 10mM * 1mL in DMSO

Sign In for Pricing
View Details
PCSK5, NT (PCSK5, PC5, PC6, Proprotein convertase subtilisin/kexin type 5, Proprotein convertase 5, Proprotein convertase 6, Subtilisin/kexin-like protease PC5) (Azide free) (HRP) discontinued
039775-HRP 200 µL

PCSK5, NT (PCSK5, PC5, PC6, Proprotein convertase subtilisin/kexin type 5, Proprotein convertase 5, Proprotein convertase 6, Subtilisin/kexin-like protease PC5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CHMP2A Overexpression Lysate (Native) - (Dry Ice)
NBL1-09159 0.1 mg

CHMP2A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
HSP90AB1 Adenovirus (Rat)
23985056 1.0 mL

HSP90AB1 Adenovirus (Rat)

Sign In for Pricing
View Details