Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIVEP1 Rabbit Polyclonal Antibody (HRP)

HIVEP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAAP, ZAS1, CIRIP, MBP-1, ZNF40, CRYBP1, ZNF40A, PRDII-BF1, Schnurri-1

UniProt

P15822

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HIVEP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP4 Rabbit Monoclonal Antibody
AMRe85355-01 1 Each

BMP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BMP4 Rabbit Monoclonal Antibody
AMRe85355-02 50 µL

BMP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BMP4 Rabbit Monoclonal Antibody
AMRe85355-03 100 µL

BMP4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Core Streptavidin 4 - 100 mg
NRPA36S-100 100mg

Recombinant Core Streptavidin 4 - 100 mg

Sign In for Pricing
View Details
YEATS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
50603126 3x 1.0µg DNA

YEATS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
UBA1 Recombinant Antibody
bsm-63004R-TR 20 µL

UBA1 Recombinant Antibody

Sign In for Pricing
View Details