Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA3 Rabbit Polyclonal Antibody (HRP)

CDCA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRCC8, TOME-1

UniProt

F8WDL1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CDCA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKEEARQPTETPVASQSSDKPSRDPETPRSSASSVPDFEEAVPGTCGHSH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001284532.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (AP)
MBS6305537-01 0.2 mL

HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (AP)

Sign In for Pricing
View Details
HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (AP)
MBS6305537-02 5x 0.2 mL

HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (AP)

Sign In for Pricing
View Details
C2orf60 Recombinant Protein (Human)
RP037456 100 µg

C2orf60 Recombinant Protein (Human)

Sign In for Pricing
View Details
ZNF667, ID (ZNF667, Zinc finger protein 667) (Azide free) (HRP) discontinued
044324-HRP 200 µL

ZNF667, ID (ZNF667, Zinc finger protein 667) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
VCP antibody
70R-21245 50 μL

VCP antibody

Sign In for Pricing
View Details
C13orf37 Protein Vector (Human) (pPM-C-His)
PV049532 500 ng

C13orf37 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details