Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL3 Rabbit Polyclonal Antibody (Biotin)

SH3GL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CNSA3, EEN-B2, SH3D2C, SH3P13, HsT19371

UniProt

Q99963

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3GL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003018

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFA/FHFA (Pan) (Acidic Fibroblast Growth Factor, AFGF, Beta Endothelial Cell Growth Factor, Fibroblast Growth Factor Homologous Factor 2A, Fibroblast Growth Factor 13A, FGF13A, Beta-Endothelial Cell Growth Factor, ECGF, ECGFA, ECGFB, Endothelial Cell Growth Factor Alpha, Endothelial Cell Growth Factor Beta, FGF 1, FGF Alpha, FGFA, Fibroblast Growth Factor 1 Acidic, Fibroblast Growth Factor 1, GLIO703, HBGF 1, Heparin Binding Growth Factor 1, Heparin Binding Growth Factor 1 Precursor, Heparin-Binding Growth Factor 1)
384902 100 µg

FGFA/FHFA (Pan) (Acidic Fibroblast Growth Factor, AFGF, Beta Endothelial Cell Growth Factor, Fibroblast Growth Factor Homologous Factor 2A, Fibroblast Growth Factor 13A, FGF13A, Beta-Endothelial Cell Growth Factor, ECGF, ECGFA, ECGFB, Endothelial Cell Growth Factor Alpha, Endothelial Cell Growth Factor Beta, FGF 1, FGF Alpha, FGFA, Fibroblast Growth Factor 1 Acidic, Fibroblast Growth Factor 1, GLIO703, HBGF 1, Heparin Binding Growth Factor 1, Heparin Binding Growth Factor 1 Precursor, Heparin-Binding Growth Factor 1)

Sign In for Pricing
View Details
PCSK1/NEC1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb2441090 100 µL

PCSK1/NEC1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
(1’R,2S) -2-[ (1’,2’-O-Isopropylidene) dihydroxyethyl]-6-fluorochroman-4-one
015118 100 mg

(1’R,2S) -2-[ (1’,2’-O-Isopropylidene) dihydroxyethyl]-6-fluorochroman-4-one

Sign In for Pricing
View Details
ACAD9 Antibody
orb2681669-01 50 µL

ACAD9 Antibody

Sign In for Pricing
View Details
ACAD9 Antibody
orb2681669-02 100 µL

ACAD9 Antibody

Sign In for Pricing
View Details
ACAD9 Antibody
orb2681669-03 200 µL

ACAD9 Antibody

Sign In for Pricing
View Details