Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP7 Rabbit Polyclonal Antibody (Biotin)

SENP7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BQF6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SENP7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSH1, NT (CSH1, Chorionic somatomammotropin hormone, Lactogen, Placental lactogen) (PE) discontinued
034278-PE 200 µL

CSH1, NT (CSH1, Chorionic somatomammotropin hormone, Lactogen, Placental lactogen) (PE) discontinued

Sign In for Pricing
View Details
PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (Biotin)
MBS6451456-01 0.1 mL

PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (Biotin)

Sign In for Pricing
View Details
PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (Biotin)
MBS6451456-02 5x 0.1 mL

PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (Biotin)

Sign In for Pricing
View Details
TRBV27 3'UTR Luciferase Stable Cell Line
TU026449 1.0 mL

TRBV27 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Sirt6 Pre-designed siRNA Set A
SI112948A 1 Each

Mouse Sirt6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
DNAJA2 antibody
MBS830371-01 0.1 mL

DNAJA2 antibody

Sign In for Pricing
View Details