Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1C2 Rabbit Polyclonal Antibody (HRP)

SULT1C2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ST1C1, ST1C2, SULT1C1, humSULTC2

UniProt

B4DLP0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SULT1C2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005264069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -,  5nm
GP-2401-B-5 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -, 5nm

Sign In for Pricing
View Details
Grin2a Mouse Monoclonal Antibody [Clone ID: N327A/38]
73-303 5 mL

Grin2a Mouse Monoclonal Antibody [Clone ID: N327A/38]

Sign In for Pricing
View Details
Tissue FFPE Sections, Parotid gland
CS800943 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-15765-01 50 μL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-15765-02 100 µL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-15765-03 1 mL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details