Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP1 Rabbit Polyclonal Antibody (Biotin)

CDK5RAP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C42, CGI-05, HSPC167, C20orf34

UniProt

Q96SZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDK5RAP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLAAGPTFQHFLKSA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RUFY3 Antibody Picoband®, iFluor647 Conjugate
A09453-1-iFluor647 100 µg

Anti-RUFY3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
SULT2A1 3'UTR Luciferase Stable Cell Line
TU024919 1.0 mL

SULT2A1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)
MBS1092320-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)
MBS1092320-02 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)
MBS1092320-03 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)
MBS1092320-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Elongation factor Tu (tuf)

Sign In for Pricing
View Details