Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXW5 Rabbit Polyclonal Antibody (Biotin)

FBXW5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fbw5

UniProt

Q969U6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXW5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3bgrl2 Mouse siRNA Oligo Duplex (Locus ID 212531)
SR401325 1 Kit

Sh3bgrl2 Mouse siRNA Oligo Duplex (Locus ID 212531)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H6]
TA805190AM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H6]

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2062593-01 0.1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2062593-02 0.2 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2062593-03 0.5 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)
MBS2062593-04 1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 14 (MMP14)

Sign In for Pricing
View Details