Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXW5 Rabbit Polyclonal Antibody (HRP)

FBXW5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbw5

UniProt

Q969U6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXW5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF3 Antibody
8C10385-AAT 50 µg

TCF3 Antibody

Sign In for Pricing
View Details
CX3CR1 Human Recombinant Protein, Synthetic Nanodisc
TP721482M 100 µg

CX3CR1 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF594 conjugate, 0.1mg/mL
BNC942314-100 1x 100 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-threo-Hex-2-enaric acid 1,4-Lactone
TRC-H294830-50MG 50 mg

L-threo-Hex-2-enaric acid 1,4-Lactone

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) pSer74 Rabbit Polyclonal Antibody
AP09459PU-N 100 µL

Cytokeratin 8 (KRT8) pSer74 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin D2 (CCND2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]
CF806252 100 µg

Cyclin D2 (CCND2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]

Sign In for Pricing
View Details