Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXW5 Rabbit Polyclonal Antibody (HRP)

FBXW5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbw5

UniProt

Q969U6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXW5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCNN1G Recombinant Rabbit monoclonal Antibody
HA751597 100 µL

SCNN1G Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396921 100 µg

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRPM2 Rabbit Polyclonal Antibody
HA500437 100 µL

TRPM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL
BNC472210-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF647 conjugate, 0.1mg/mL
BNC471688-100 1x 100 µL

CD79a (IGA/1688R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A5]
TA808453AM 100 µL

GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A5]

Sign In for Pricing
View Details