Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR3 Rabbit Polyclonal Antibody (FITC)

PHACTR3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101

UniProt

Q96KR7

Immunogen

The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate
294026-01 10 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate

Sign In for Pricing
View Details
Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate
294026-02 25 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate

Sign In for Pricing
View Details
Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate
294026-03 50 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate-7-phosphate

Sign In for Pricing
View Details
ZNF492 CRISPR Activation Plasmid (h)
sc-412859-ACT 20 µg

ZNF492 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Abcc9 siRNA Oligos set (Rat)
11057176 3x 5 nmol

Abcc9 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PRKD3 CRISPR Knock Out 293T Cell Line (Human)
37650141 1x 10^6 Cells / 1.0 mL

PRKD3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details