Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR3 Rabbit Polyclonal Antibody (HRP)

PHACTR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101

UniProt

Q96KR7

Immunogen

The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C5 (NM_012087) Human Over-expression Lysate
LS009328-20ug 20 µg

GTF3C5 (NM_012087) Human Over-expression Lysate

Sign In for Pricing
View Details
APBB3 Polyclonal Antibody, HRP Conjugated
bs-11637R-HRP 100 µL

APBB3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RPS16P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42158151 3x 1.0 µg DNA

RPS16P2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
(S)-SNAP 5114
1561/50 50 mg

(S)-SNAP 5114

Sign In for Pricing
View Details
C20orf202 Polyclonal Antibody, Cy7 Conjugated
bs-15105R-Cy7 100 µL

C20orf202 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ATP6V1E2 Human shRNA Plasmid Kit (Locus ID 90423)
TR306497 1 Kit

ATP6V1E2 Human shRNA Plasmid Kit (Locus ID 90423)

Sign In for Pricing
View Details