Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP1 Rabbit Polyclonal Antibody (HRP)

ARFIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSU52521

UniProt

P53367

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARFIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOPAZ1 Human Gene Knockout Kit (CRISPR)
KN427401 1 Kit

TOPAZ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GATA3 Mouse Monoclonal Antibody [Clone ID: OTI4D5]
CF809143 100 µg

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI4D5]

Sign In for Pricing
View Details
ABHD12 Antibody
8C14209-AAT 50 µg

ABHD12 Antibody

Sign In for Pricing
View Details
Septin 8 (SEPT8) (NM_001098811) Human Over-expression Lysate
LC420343 20 µg

Septin 8 (SEPT8) (NM_001098811) Human Over-expression Lysate

Sign In for Pricing
View Details
Collagen IX (COL9A1) alpha 1 chain Rabbit Polyclonal Antibody
AP12402PU-N 400 µL

Collagen IX (COL9A1) alpha 1 chain Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TLNRD1 activation kit by CRISPRa
GA111815 1 Kit

Human TLNRD1 activation kit by CRISPRa

Sign In for Pricing
View Details