Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39L Rabbit Polyclonal Antibody (FITC)

CAB39L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MO2L, MO25-BETA, bA103J18.3

UniProt

Q9H9S4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CAB39L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVFVASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001073138.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 750)
MBS6370758-01 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 750)

Sign In for Pricing
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 750)
MBS6370758-02 5x 0.1 mL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 750)

Sign In for Pricing
View Details
MIER1 antibody
31839 100 µL

MIER1 antibody

Sign In for Pricing
View Details
Recombinant Thyroxine Binding Globulin (TBG)
MBS2009639-01 0.01 mg

Recombinant Thyroxine Binding Globulin (TBG)

Sign In for Pricing
View Details
Recombinant Thyroxine Binding Globulin (TBG)
MBS2009639-02 0.05 mg

Recombinant Thyroxine Binding Globulin (TBG)

Sign In for Pricing
View Details
Recombinant Thyroxine Binding Globulin (TBG)
MBS2009639-03 0.1 mg

Recombinant Thyroxine Binding Globulin (TBG)

Sign In for Pricing
View Details