Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAH1 Rabbit Polyclonal Antibody (HRP)

IAH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q2TAA2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human IAH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001034702.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-01 0.01 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-02 0.05 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-03 0.5 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-04 5x 0.5 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
CYP4Z1 (N-term) Rabbit Polyclonal Antibody
AP14737PU-N 400 µL

CYP4Z1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ANKS6 sgRNA gene knockout kit - Lentiviral human ANKS6 sgRNA gene knockout kit (plasmid)
GTR15376847 1 Vial

Lentiviral human ANKS6 sgRNA gene knockout kit - Lentiviral human ANKS6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details