Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT14 Rabbit Polyclonal Antibody (HRP)

KAT14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATAC2, CRP2BP, CSRP2BP, PRO1194, dJ717M23.1

UniProt

Q9H8E8

Immunogen

The immunogen for Anti-CSRP2BP antibody is: synthetic peptide directed towards the N-terminal region of Human CSR2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESEDQASVDLSHDQSGDSLNSDEGDVSWMEEQLSYFCDKCQKWIPASQLR

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_065397.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Brain
CS802904 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), Biotin conjugate, 0.1mg/mL
BNCB2010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPSE2 Human Gene Knockout Kit (CRISPR)
KN216534 1 Kit

HPSE2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Progesterone (6-5E-10B), CF568 conjugate, 0.1mg/mL
BNC680237-500 1x 500 µL

Progesterone (6-5E-10B), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Glucokinase (GCK) ELISA Kit
RD-GCK-Ra-01 96 Tests

Rat Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details
Rat Glucokinase (GCK) ELISA Kit
RD-GCK-Ra-02 48 Tests

Rat Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details