Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDCD3 Rabbit Polyclonal Antibody (Biotin)

NUDCD3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NudCL

UniProt

Q8IVD9

Immunogen

The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_056147.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRBD1 Human Over-expression Lysate
orb1369708 20 µg

SRBD1 Human Over-expression Lysate

Sign In for Pricing
View Details
Canine C-Peptide ELISA Kit
orb1667058-01 48 Tests

Canine C-Peptide ELISA Kit

Sign In for Pricing
View Details
Canine C-Peptide ELISA Kit
orb1667058-02 96 Tests

Canine C-Peptide ELISA Kit

Sign In for Pricing
View Details
CIRBP Recombinant Protein (Rat)
RP195086 100 µg

CIRBP Recombinant Protein (Rat)

Sign In for Pricing
View Details
BHLH3, NT (BHLHE41, BHLHB3, DEC2, SHARP1, Class E basic helix-loop-helix protein 41, Class B basic helix-loop-helix protein 3, Differentially expressed in chondrocytes protein 2, Enhancer-of-split and hairy-related protein 1) (MaxLight 490) discontinued
032506-ML490 100 µL

BHLH3, NT (BHLHE41, BHLHB3, DEC2, SHARP1, Class E basic helix-loop-helix protein 41, Class B basic helix-loop-helix protein 3, Differentially expressed in chondrocytes protein 2, Enhancer-of-split and hairy-related protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse 17-alpha-Hydroxyprogesterone ELISA Kit
MBS3807346-01 48 Well

Mouse 17-alpha-Hydroxyprogesterone ELISA Kit

Sign In for Pricing
View Details