Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM91A1 Rabbit Polyclonal Antibody (HRP)

FAM91A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q658Y4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human FAM91A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLCGYVTMLNASSQLADRKLSDASDERGEPDLASGSDVNGSTESFEMVIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659400.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stability Test Chamber BTST-201-A
BTST-201-A 1 Unit

Stability Test Chamber BTST-201-A

Sign In for Pricing
View Details
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA374288 100 µL

Caspase 8 (CASP8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC23 (NM_001040658) Human Over-expression Lysate
LC421799 20 µg

TTC23 (NM_001040658) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS635146 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS712574 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a,  40nm
GM-301-40 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a, 40nm

Sign In for Pricing
View Details