Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC28A Rabbit Polyclonal Antibody (Biotin)

CCDC28A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6orf80, CCRL1AP

UniProt

Q8IWP9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC28A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Smpdl3b shRNA (UAS) - Lentiviral mouseSmpdl3b shRNA (UAS, GFP) (25)
GTR15234992 1 Vial

Lentiviral mouse Smpdl3b shRNA (UAS) - Lentiviral mouseSmpdl3b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Pharmed Tube, 12.70 x 3.20 mm
1210141 7,5 PK

Pharmed Tube, 12.70 x 3.20 mm

Sign In for Pricing
View Details
Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit
MBS2904522-01 48 Well

Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit

Sign In for Pricing
View Details
Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit
MBS2904522-02 96 Well

Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit

Sign In for Pricing
View Details
Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit
MBS2904522-03 5x 96 Well

Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit

Sign In for Pricing
View Details
Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit
MBS2904522-04 10x 96 Well

Chicken BCO1/Beta,beta-carotene 15,15'-dioxygenase ELISA Kit

Sign In for Pricing
View Details