Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC28A Rabbit Polyclonal Antibody (HRP)

CCDC28A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf80, CCRL1AP

UniProt

Q8IWP9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC28A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp13 (BC052082) Mouse Tagged ORF Clone
MG208223 10 µg

Zfp13 (BC052082) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TBCCD1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2342404 1.0 µg DNA

TBCCD1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human SHH Protein
E30PQ092 20 µg

Recombinant Human SHH Protein

Sign In for Pricing
View Details
Rabbit Polyclonal RanBP3 Antibody [PE]
NBP2-97450PE 0.1 mL

Rabbit Polyclonal RanBP3 Antibody [PE]

Sign In for Pricing
View Details
TRNAF13P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48022061 1.0 µg DNA

TRNAF13P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LCE4A (NM_178356) Human Over-expression Lysate
LC405979 20 µg

LCE4A (NM_178356) Human Over-expression Lysate

Sign In for Pricing
View Details