Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAREM1 Rabbit Polyclonal Antibody (Biotin)

GAREM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GAREM, Gm944, FAM59A, C18orf11

UniProt

Q9H706

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAREM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPFGSPSAEAVSSRLSWPNHYSGASESQTRSDFLLDPSRSYSYPRQKTPG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MAP3K11 shRNA (UAS) - Lentiviral human MAP3K11 shRNA (UAS, iRFP) (100)
GTR15332298 1 Vial

Lentiviral human MAP3K11 shRNA (UAS) - Lentiviral human MAP3K11 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal Leukotriene B4 R1 Antibody (203/14F11) [Janelia Fluor 669]
FAB099JF669 0.5 mL

Mouse Monoclonal Leukotriene B4 R1 Antibody (203/14F11) [Janelia Fluor 669]

Sign In for Pricing
View Details
PKC ζ shRNA (bovine) Lentiviral Particles
sc-108082-V 200 µL

PKC ζ shRNA (bovine) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi Homoserine kinase (thrB)
MBS1319915-01 0.02 mg (E-Coli)

Recombinant Pyrococcus abyssi Homoserine kinase (thrB)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi Homoserine kinase (thrB)
MBS1319915-02 0.02 mg (Yeast)

Recombinant Pyrococcus abyssi Homoserine kinase (thrB)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi Homoserine kinase (thrB)
MBS1319915-03 0.1 mg (E-Coli)

Recombinant Pyrococcus abyssi Homoserine kinase (thrB)

Sign In for Pricing
View Details