Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAREM1 Rabbit Polyclonal Antibody (HRP)

GAREM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAREM, Gm944, FAM59A, C18orf11

UniProt

Q9H706

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAREM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPFGSPSAEAVSSRLSWPNHYSGASESQTRSDFLLDPSRSYSYPRQKTPG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA,  10nm
GAF-351-10 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA, 10nm

Sign In for Pricing
View Details
VPS28 (NM_183057) Human Recombinant Protein
TP308726 20 µg

VPS28 (NM_183057) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CLIC3 Protein (His Tag)
PKSH032248-01 10 µg

Recombinant Human CLIC3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CLIC3 Protein (His Tag)
PKSH032248-02 50 µg

Recombinant Human CLIC3 Protein (His Tag)

Sign In for Pricing
View Details
BNIP3L Antibody
KC-2373-01 50 μL

BNIP3L Antibody

Sign In for Pricing
View Details
BNIP3L Antibody
KC-2373-02 100 µL

BNIP3L Antibody

Sign In for Pricing
View Details