Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF6 Rabbit Polyclonal Antibody (HRP)

DCAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRIP, ARCAP, IQWD1, PC326, MSTP055, 1200006M05Rik

UniProt

Q58WW2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human DCAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001017977.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE11A Rabbit Polyclonal Antibody
AP00662SU-N 100 µL

PDE11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS514051 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
GC1q R Mouse Monoclonal Antibody [A8F5]
HA601068 100 µL

GC1q R Mouse Monoclonal Antibody [A8F5]

Sign In for Pricing
View Details
Human PKHD1L1 activation kit by CRISPRa
GA114258 1 Kit

Human PKHD1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD8B Mouse Monoclonal Antibody [Clone ID: EP42]
AM08123FC-N 500 µg

CD8B Mouse Monoclonal Antibody [Clone ID: EP42]

Sign In for Pricing
View Details
PPT2 Human qPCR Primer Pair (NM_138717)
HP229758 200 Reactions

PPT2 Human qPCR Primer Pair (NM_138717)

Sign In for Pricing
View Details