Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS11 Rabbit Polyclonal Antibody (FITC)

INTS11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RC68, INT11, RC-68, CPSF3L, CPSF73L

UniProt

Q5TA45

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CPSF3L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001243385.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (APC)
MBS6122766-01 0.1 mL

CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (APC)

Sign In for Pricing
View Details
CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (APC)
MBS6122766-02 5x 0.1 mL

CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (APC)

Sign In for Pricing
View Details
Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein
abx659102-01 10 µg

Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein

Sign In for Pricing
View Details
Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein
abx659102-02 50 µg

Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein

Sign In for Pricing
View Details
Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein
abx659102-03 100 µg

Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein

Sign In for Pricing
View Details
Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein
abx659102-04 200 µg

Human NAD-Dependent Protein Deacylase Sirtuin-6 (SIRT6) Protein

Sign In for Pricing
View Details