Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN8 Rabbit Polyclonal Antibody (HRP)

UBXN8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REP8, UBXD6, D8S2298E

UniProt

O00124

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UBXN8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005662

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHPF Pre-designed siRNA Set B
SI003023B 1 Each

Human CHPF Pre-designed siRNA Set B

Sign In for Pricing
View Details
KCND1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25344061 1.0 µg DNA

KCND1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial
MBS1086560 Inquire

Recombinant Influenza A virus RNA-directed RNA polymerase catalytic subunit (PB1), partial

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)
MBS1302913-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)
MBS1302913-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)
MBS1302913-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Proable nucleoside diphosphate kinase DDB_G0292928 (DDB_G0292928)

Sign In for Pricing
View Details