Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF16 Rabbit Polyclonal Antibody (Biotin)

DCAF16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C4orf30

UniProt

Q9NXF7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005248228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184) (HRP)
129931-HRP 100 µL

MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184) (HRP)

Sign In for Pricing
View Details
CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Antigen p150,95 alpha Subunit, Myeloid Membrane Antigen alpha Subunit, p150,95 Integrin alpha Chain) (MaxLight 650) discontinued
C2262-56J-ML650 100 µL

CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Antigen p150,95 alpha Subunit, Myeloid Membrane Antigen alpha Subunit, p150,95 Integrin alpha Chain) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Tiaprofenic acid D3
T13155-01 5 mg

Tiaprofenic acid D3

Sign In for Pricing
View Details
Tiaprofenic acid D3
T13155-02 1 mg

Tiaprofenic acid D3

Sign In for Pricing
View Details
Cdk7, phosphorylated (T170) (STK1, p39 Mo15, 39kD protein kinase, TFIIH basal transcription factor complex kinase subunit, CAK1, CDK-activating kinase, CAK, Cell division protein kinase 7, MO15, CDK7) (MaxLight 650) discontinued
033681-ML650 100 µL

Cdk7, phosphorylated (T170) (STK1, p39 Mo15, 39kD protein kinase, TFIIH basal transcription factor complex kinase subunit, CAK1, CDK-activating kinase, CAK, Cell division protein kinase 7, MO15, CDK7) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Zfp169 Protein Vector (Mouse) (pPB-N-His)
PV248919 500 ng

Zfp169 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details