Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF846 Rabbit Polyclonal Antibody (FITC)

ZNF846 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q147U1

Immunogen

The immunogen for Anti-ZNF846 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN846

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAF

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryo-Babies, small, white labels for 0.5 mL tubes, 0.94 inch L x 0.5 inch W, 119/sheet, 2380/box
9187-2380 2380 / Box

Cryo-Babies, small, white labels for 0.5 mL tubes, 0.94 inch L x 0.5 inch W, 119/sheet, 2380/box

Sign In for Pricing
View Details
NOBOX Antibody
orb1329120 100 µg

NOBOX Antibody

Sign In for Pricing
View Details
Upadacitinib Impurity 34
CS-O-58516 1 Each

Upadacitinib Impurity 34

Sign In for Pricing
View Details
ALOX15B Protein Vector (Rat) (pPB-C-His)
PV253318 500 ng

ALOX15B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Human CD19 Antibody (SAA0005), PE
HB996127-01 1 Each

Anti-Human CD19 Antibody (SAA0005), PE

Sign In for Pricing
View Details
Anti-Human CD19 Antibody (SAA0005), PE
HB996127-02 100 Tests

Anti-Human CD19 Antibody (SAA0005), PE

Sign In for Pricing
View Details