Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF846 Rabbit Polyclonal Antibody (HRP)

ZNF846 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q147U1

Immunogen

The immunogen for Anti-ZNF846 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN846

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAF

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REPS1 rabbit pAb Antibody
orb770674-01 50 μL

REPS1 rabbit pAb Antibody

Sign In for Pricing
View Details
REPS1 rabbit pAb Antibody
orb770674-02 100 µL

REPS1 rabbit pAb Antibody

Sign In for Pricing
View Details
Biotinyl-Tau Peptide (306-336) (Repeat 3 Domain) (human)
4088980.1 1 mg

Biotinyl-Tau Peptide (306-336) (Repeat 3 Domain) (human)

Sign In for Pricing
View Details
Sheep Carbohyde sulfotransferase 3 (CHST3) ELISA kit
GTR10417922 96 Well

Sheep Carbohyde sulfotransferase 3 (CHST3) ELISA kit

Sign In for Pricing
View Details
SOX5 Peptide - middle region (AAP89383)
AAP89383-100UG 100 µg

SOX5 Peptide - middle region (AAP89383)

Sign In for Pricing
View Details
OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA- (Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1)
130694 50 µg

OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA- (Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1)

Sign In for Pricing
View Details