Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPDU1 Rabbit Polyclonal Antibody (Biotin)

MPDU1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SL15, CDGIF, Lec35, My008, PQLC5, PP3958, SLC66A5, HBEBP2BPA

UniProt

O75352

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPDU1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_004861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX7C Rabbit Polyclonal Antibody (BF750)
orb2518939 100 µL

COX7C Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CAMP, CT (CAMP, CAP18, FALL39, Cathelicidin antimicrobial peptide, 18kD cationic antimicrobial protein, Antibacterial protein FALL-39, FALL-39 peptide antibiotic, Antibacterial protein LL-37) (PE)
MBS6280693-01 0.2 mL

CAMP, CT (CAMP, CAP18, FALL39, Cathelicidin antimicrobial peptide, 18kD cationic antimicrobial protein, Antibacterial protein FALL-39, FALL-39 peptide antibiotic, Antibacterial protein LL-37) (PE)

Sign In for Pricing
View Details
CAMP, CT (CAMP, CAP18, FALL39, Cathelicidin antimicrobial peptide, 18kD cationic antimicrobial protein, Antibacterial protein FALL-39, FALL-39 peptide antibiotic, Antibacterial protein LL-37) (PE)
MBS6280693-02 5x 0.2 mL

CAMP, CT (CAMP, CAP18, FALL39, Cathelicidin antimicrobial peptide, 18kD cationic antimicrobial protein, Antibacterial protein FALL-39, FALL-39 peptide antibiotic, Antibacterial protein LL-37) (PE)

Sign In for Pricing
View Details
Lentiviral mouse Cdh16 shRNA (UAS) - Lentiviral mouseCdh16 shRNA (UAS, GFP) (25)
GTR15210092 1 Vial

Lentiviral mouse Cdh16 shRNA (UAS) - Lentiviral mouseCdh16 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Dual Specificity Phosphatase 1 (DUSP1)
TRV-0009834-01 10 µg

Recombinant Dual Specificity Phosphatase 1 (DUSP1)

Sign In for Pricing
View Details
Recombinant Dual Specificity Phosphatase 1 (DUSP1)
TRV-0009834-02 50 µg

Recombinant Dual Specificity Phosphatase 1 (DUSP1)

Sign In for Pricing
View Details