Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPDU1 Rabbit Polyclonal Antibody (HRP)

MPDU1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SL15, CDGIF, Lec35, My008, PQLC5, PP3958, SLC66A5, HBEBP2BPA

UniProt

O75352

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPDU1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_004861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT43 (NM_052873) Human Tagged ORF Clone
RC203591 10 µg

IFT43 (NM_052873) Human Tagged ORF Clone

Sign In for Pricing
View Details
RBM45 (NM_152945) Human Tagged ORF Clone
RC208995 10 µg

RBM45 (NM_152945) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Wbp11 (NM_021714) AAV Particle
MR220672A1V 250 µL

Mouse Wbp11 (NM_021714) AAV Particle

Sign In for Pricing
View Details
SAMHD1 (SAM Domain and HD Domain 1, DCIP, HDDC1, MOP-5, SBBI88) (APC)
MBS6451609-01 0.1 mL

SAMHD1 (SAM Domain and HD Domain 1, DCIP, HDDC1, MOP-5, SBBI88) (APC)

Sign In for Pricing
View Details
SAMHD1 (SAM Domain and HD Domain 1, DCIP, HDDC1, MOP-5, SBBI88) (APC)
MBS6451609-02 5x 0.1 mL

SAMHD1 (SAM Domain and HD Domain 1, DCIP, HDDC1, MOP-5, SBBI88) (APC)

Sign In for Pricing
View Details
Olfr1155 (NM_146643) Mouse Tagged Lenti ORF Clone
MR213177L4 10 µg

Olfr1155 (NM_146643) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details