Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arfrp1 Rabbit Polyclonal Antibody (Biotin)

Arfrp1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q63055

Immunogen

The immunogen for Anti-Arfrp1 antibody is: synthetic peptide directed towards the N-terminal of Rat ARFRP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Rat

Tested Applications

WB

NCBI Accession Number

XP_006235780.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35F5 (Solute Carrier Family 35 Member F5, Hepatitis C Virus NS5A-transactivated Protein 3, HCV NS5A-transactivated Protein 3, NS5ATP3, UNQ2545/PRO6097) (MaxLight 550)
138371-ML550 100 µL

SLC35F5 (Solute Carrier Family 35 Member F5, Hepatitis C Virus NS5A-transactivated Protein 3, HCV NS5A-transactivated Protein 3, NS5ATP3, UNQ2545/PRO6097) (MaxLight 550)

Sign In for Pricing
View Details
LOC100302372 3'UTR GFP Stable Cell Line
TU257176 1.0 mL

LOC100302372 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CBX3 (Chromobox Homolog 3, HECH, HP1-GAMMA, HP1Hs-gamma, HP1gamma) discontinued
209918-01 20 µL

CBX3 (Chromobox Homolog 3, HECH, HP1-GAMMA, HP1Hs-gamma, HP1gamma) discontinued

Sign In for Pricing
View Details
CBX3 (Chromobox Homolog 3, HECH, HP1-GAMMA, HP1Hs-gamma, HP1gamma) discontinued
209918-02 100 µL

CBX3 (Chromobox Homolog 3, HECH, HP1-GAMMA, HP1Hs-gamma, HP1gamma) discontinued

Sign In for Pricing
View Details
PKP2 Antibody, HRP conjugated
CSB-PA859116LB01HU-01 50 µg

PKP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PKP2 Antibody, HRP conjugated
CSB-PA859116LB01HU-02 100 µg

PKP2 Antibody, HRP conjugated

Sign In for Pricing
View Details