Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO2 Rabbit Polyclonal Antibody (HRP)

CALCOCO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NDP52

UniProt

Q13137

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CALCOCO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAOB (Amine Oxidase [Flavin-containing] B, Monoamine Oxidase Type B, MAO-B, MGC26382)
MBS6004608-01 0.1 mg

MAOB (Amine Oxidase [Flavin-containing] B, Monoamine Oxidase Type B, MAO-B, MGC26382)

Sign In for Pricing
View Details
MAOB (Amine Oxidase [Flavin-containing] B, Monoamine Oxidase Type B, MAO-B, MGC26382)
MBS6004608-02 5x 0.1 mg

MAOB (Amine Oxidase [Flavin-containing] B, Monoamine Oxidase Type B, MAO-B, MGC26382)

Sign In for Pricing
View Details
Anti-Human Follistatin
RHF462 100 µg

Anti-Human Follistatin

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)
MBS2074951-01 0.1 mL

FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)
MBS2074951-02 0.2 mL

FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)
MBS2074951-03 0.5 mL

FITC-Linked Polyclonal Antibody to Cell Division Cycle Protein 25 (CDC25)

Sign In for Pricing
View Details