Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPCAM Rabbit Polyclonal Antibody (HRP)

EPCAM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ESA, KSA, M4S1, MK-1, DIAR5, EGP-2, EGP40, KS1/4, MIC18, TROP1, EGP314, HNPCC8, TACSTD1

UniProt

P16422

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPCAM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTD

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK (phospho Tyr84) Polyclonal Antibody
E20-60802 100 µg

BLNK (phospho Tyr84) Polyclonal Antibody

Sign In for Pricing
View Details
Rat SMC Growth Medium
R311-500 500 mL

Rat SMC Growth Medium

Sign In for Pricing
View Details
RTP4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11618R-BF594 100 µL

RTP4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7) (MaxLight 650)
246293-ML650 100 µL

FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7) (MaxLight 650)

Sign In for Pricing
View Details
GENLISA™ Human Solute carrier family 12 member 1 (SLC12A1) ELISA
KBH22427 96 Well

GENLISA™ Human Solute carrier family 12 member 1 (SLC12A1) ELISA

Sign In for Pricing
View Details
FAST Lentiviral Activation Particles (m)
sc-426090-LAC 200 µL

FAST Lentiviral Activation Particles (m)

Sign In for Pricing
View Details