Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA4 Rabbit Polyclonal Antibody (HRP)

EYA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CMD1J, DFNA10

UniProt

O95677

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrap 3'UTR Luciferase Stable Cell Line
TU213360 1.0 mL

Mrap 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody (RBITC)
orb1075977 100 µL

GRTP1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 550)
MBS6455135-01 0.1 mL

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 550)

Sign In for Pricing
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 550)
MBS6455135-02 5x 0.1 mL

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 550)

Sign In for Pricing
View Details
Human Tyrosine-Protein Kinase ABL1 (ABL1) ELISA Kit
MBS9714534-01 48 Tests

Human Tyrosine-Protein Kinase ABL1 (ABL1) ELISA Kit

Sign In for Pricing
View Details
Human Tyrosine-Protein Kinase ABL1 (ABL1) ELISA Kit
MBS9714534-02 96 Tests

Human Tyrosine-Protein Kinase ABL1 (ABL1) ELISA Kit

Sign In for Pricing
View Details