Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT Rabbit Polyclonal Antibody (Biotin)

FHIT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FRA3B, AP3Aase

UniProt

P49789

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FHIT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005265010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex (MAC) Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, MGC2354, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20, Protectin, Surface Anitgen Recognized by Monoclonal Antibody 16.3A5, T cell Activating Protein) (MaxLight 405) discontinued
C2413-21V-ML405 100 µL

CD59 (16.3A5, 1F5, CD59a, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, 20kD Homologous Restriction Factor, HRF20, HRF-20, Human Leukocyte Antigen MIC11, Ly-6-like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex (MAC) Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, MGC2354, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20, Protectin, Surface Anitgen Recognized by Monoclonal Antibody 16.3A5, T cell Activating Protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: DX3]
AM08166AC-N 100 Tests

CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: DX3]

Sign In for Pricing
View Details
ACSL6 Antibody (HRP)
orb752383-01 50 μL

ACSL6 Antibody (HRP)

Sign In for Pricing
View Details
ACSL6 Antibody (HRP)
orb752383-02 100 µL

ACSL6 Antibody (HRP)

Sign In for Pricing
View Details
CMKLR1 Rabbit Polyclonal Antibody (Cy7)
orb1057809 100 µL

CMKLR1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
S-1-Propenyl-L-cysteine 50mg
A19819-50 50 mg

S-1-Propenyl-L-cysteine 50mg

Sign In for Pricing
View Details