Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFI1 Rabbit Polyclonal Antibody (FITC)

GFI1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SCN2, GFI-1, GFI1A, ZNF163

UniProt

Q99684

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GFI1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005270806

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPD1, CT (Small Nuclear Ribonucleoprotein Sm D1, Sm-D1, snRNP Core Protein D1, Sm-D Autoantigen) (FITC)
MBS6499999-01 0.2 mL

SNRPD1, CT (Small Nuclear Ribonucleoprotein Sm D1, Sm-D1, snRNP Core Protein D1, Sm-D Autoantigen) (FITC)

Sign In for Pricing
View Details
SNRPD1, CT (Small Nuclear Ribonucleoprotein Sm D1, Sm-D1, snRNP Core Protein D1, Sm-D Autoantigen) (FITC)
MBS6499999-02 5x 0.2 mL

SNRPD1, CT (Small Nuclear Ribonucleoprotein Sm D1, Sm-D1, snRNP Core Protein D1, Sm-D Autoantigen) (FITC)

Sign In for Pricing
View Details
Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)
MBS1133987-01 0.05 mg (E-Coli)

Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)

Sign In for Pricing
View Details
Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)
MBS1133987-02 0.2 mg (E-Coli)

Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)

Sign In for Pricing
View Details
Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)
MBS1133987-03 0.05 mg (Yeast)

Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)

Sign In for Pricing
View Details
Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)
MBS1133987-04 0.5 mg (E-Coli)

Recombinant Pisum sativum 20 kDa chaperonin, chloroplastic (CPN21)

Sign In for Pricing
View Details