Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B Rabbit Polyclonal Antibody (HRP)

COX5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COXVB

UniProt

P10606

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human COX5B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 750) discontinued
123139-ML750 100 µL

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Goat Glucose Regulated Protein 78 ELISA Kit
MBS7258744-01 48 Well

Goat Glucose Regulated Protein 78 ELISA Kit

Sign In for Pricing
View Details
Goat Glucose Regulated Protein 78 ELISA Kit
MBS7258744-02 96 Well

Goat Glucose Regulated Protein 78 ELISA Kit

Sign In for Pricing
View Details
Goat Glucose Regulated Protein 78 ELISA Kit
MBS7258744-03 5x 96 Well

Goat Glucose Regulated Protein 78 ELISA Kit

Sign In for Pricing
View Details
Goat Glucose Regulated Protein 78 ELISA Kit
MBS7258744-04 10x 96 Well

Goat Glucose Regulated Protein 78 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 768 (ZNF768)
MBS1414377-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 768 (ZNF768)

Sign In for Pricing
View Details