Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREM Rabbit Polyclonal Antibody (Biotin)

CREM Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ICER, CREM-2, hCREM-2

UniProt

Q03060

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CREM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (MaxLight 490)
MBS6371778-01 0.1 mL

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (MaxLight 490)

Sign In for Pricing
View Details
C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (MaxLight 490)
MBS6371778-02 5x 0.1 mL

C9orf95 (NMRK1, NRK1, Nicotinamide Riboside Kinase 1, Nicotinic Acid Riboside Kinase 1, Ribosylnicotinamide Kinase 1, Ribosylnicotinic Acid Kinase 1, FLJ20559) (MaxLight 490)

Sign In for Pricing
View Details
HSP70 Interacting Protein Human Recombinant (ST13 Human)
PT_42133-01 10 µg

HSP70 Interacting Protein Human Recombinant (ST13 Human)

Sign In for Pricing
View Details
HSP70 Interacting Protein Human Recombinant (ST13 Human)
PT_42133-02 50 µg

HSP70 Interacting Protein Human Recombinant (ST13 Human)

Sign In for Pricing
View Details
HSP70 Interacting Protein Human Recombinant (ST13 Human)
PT_42133-03 1 mg

HSP70 Interacting Protein Human Recombinant (ST13 Human)

Sign In for Pricing
View Details
Lentiviral human COL6A1 shRNA (UAS) - Lentiviral human COL6A1 shRNA (UAS, GFP) plasmid
GTR15139378 1 Vial

Lentiviral human COL6A1 shRNA (UAS) - Lentiviral human COL6A1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details