Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Rabbit Polyclonal Antibody (HRP)

EIF5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF-4D, eIF5AI

UniProt

P63241

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)
KTE110042-01 48 Tests

ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)

Sign In for Pricing
View Details
ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)
KTE110042-02 96 Tests

ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)

Sign In for Pricing
View Details
ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)
KTE110042-03 5x 96 Well

ELISA kit for Sheep Matrix metallopeptidase 3 (MMP3)

Sign In for Pricing
View Details
CTSA Protein Vector (Human) (pPM-C-His)
PV011120 500 ng

CTSA Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PPP1CB 3'UTR GFP Stable Cell Line
TU068619 1.0 mL

PPP1CB 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DNAJC10 CRISPR All-in-one AAV vector set (with saCas9)(Human)
18391151 3x 1.0 µg DNA

DNAJC10 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details