Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41L3 Rabbit Polyclonal Antibody (Biotin)

EPB41L3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

4.1B, DAL1, DAL-1

UniProt

Q9Y2J2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human E41L3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) (AP) discontinued
031942-AP 200 µL

AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein complex 2 alpha-A large chain, Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit) (AP) discontinued

Sign In for Pricing
View Details
Swiprosin-2 monoclonal antibody
MB65980-01 50 µL

Swiprosin-2 monoclonal antibody

Sign In for Pricing
View Details
Swiprosin-2 monoclonal antibody
MB65980-02 100 µL

Swiprosin-2 monoclonal antibody

Sign In for Pricing
View Details
PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)
MBS6430608-01 0.1 mL

PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)

Sign In for Pricing
View Details
PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)
MBS6430608-02 5x 0.1 mL

PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)

Sign In for Pricing
View Details
NUP107 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV697562 1.0 µg DNA

NUP107 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details