Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Rabbit Polyclonal Antibody (FITC)

IL3RA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra

UniProt

P26951

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL3RA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005274837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phka1 Rat shRNA Lentiviral Particle (Locus ID 64561)
TL710786V 500 µL Each

Phka1 Rat shRNA Lentiviral Particle (Locus ID 64561)

Sign In for Pricing
View Details
Mouse IQGAP2 siRNA
abx920765-01 15 nmol

Mouse IQGAP2 siRNA

Sign In for Pricing
View Details
Mouse IQGAP2 siRNA
abx920765-02 30 nmol

Mouse IQGAP2 siRNA

Sign In for Pricing
View Details
B3gnt9-ps sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4027302 1.0 µg DNA

B3gnt9-ps sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (HRP)
MBS6372865-01 0.1 mL

CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (HRP)

Sign In for Pricing
View Details
CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (HRP)
MBS6372865-02 5x 0.1 mL

CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12) (HRP)

Sign In for Pricing
View Details