Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Rabbit Polyclonal Antibody (HRP)

IL3RA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra

UniProt

P26951

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL3RA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005274837

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 1 (Biotin)
545712 200 µL

Caspase 1 (Biotin)

Sign In for Pricing
View Details
Cardiac Troponin T Rabbit Polyclonal Antibody (PE-Cy5)
orb888326 100 µL

Cardiac Troponin T Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
TREM-1 (Triggering Receptor Expressed on Monocytes 1, Triggering Receptor Expressed on Myeloid Cells 1 Precursor) discontinued
T8282-09C 25 µg

TREM-1 (Triggering Receptor Expressed on Monocytes 1, Triggering Receptor Expressed on Myeloid Cells 1 Precursor) discontinued

Sign In for Pricing
View Details
Human POLQ / DNA polymerase theta ELISA Kit
MBS2905282-01 48 Well

Human POLQ / DNA polymerase theta ELISA Kit

Sign In for Pricing
View Details
Human POLQ / DNA polymerase theta ELISA Kit
MBS2905282-02 96 Well

Human POLQ / DNA polymerase theta ELISA Kit

Sign In for Pricing
View Details
Human POLQ / DNA polymerase theta ELISA Kit
MBS2905282-03 5x 96 Well

Human POLQ / DNA polymerase theta ELISA Kit

Sign In for Pricing
View Details