Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF13A Rabbit Polyclonal Antibody (FITC)

KIF13A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RBKIN, bA500C11.2

UniProt

Q9H1H9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KI13A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPSNTKQGERKPPKVFAFDYCFWSMDESNTTKYAGQEVVFKCLGEGILEK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

198kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_071396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Cytochrome b Polyclonal Antibody
PA88499HU-01 50 µg

Rabbit Anti-Human Cytochrome b Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytochrome b Polyclonal Antibody
PA88499HU-02 100 µg

Rabbit Anti-Human Cytochrome b Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytochrome b Polyclonal Antibody
PA88499HU-03 500 µg

Rabbit Anti-Human Cytochrome b Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cytochrome b Polyclonal Antibody
PA88499HU-04 1 mg

Rabbit Anti-Human Cytochrome b Polyclonal Antibody

Sign In for Pricing
View Details
C-Myc Oncoprotein Class E basic helix-loop-helix protein 39 (bHLHe39), MRTL, Myc2, Niard, Nird, Proto-oncogene c-Myc, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, V-Myc avian myelocytomatosis viral oncogene homolog (BSA & Azide Free) (MaxLight 405) discontinued
168657-AF-ML405 100 µL

C-Myc Oncoprotein Class E basic helix-loop-helix protein 39 (bHLHe39), MRTL, Myc2, Niard, Nird, Proto-oncogene c-Myc, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, V-Myc avian myelocytomatosis viral oncogene homolog (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
UNC93B4 3'UTR GFP Stable Cell Line
TU077845 1.0 mL

UNC93B4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details